My watch list
my.bionity.com  
Login  

Marine Drugs, Vol. 11, Pages 1800-1814: A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata

A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNH DGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRK NNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/ TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC50 values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively.

Authors:   Chen, Lili ; Song, Liyan ; Li, Tingfei ; Zhu, Jianhua ; Xu, Jian ; Zheng, Qin ; Yu, Rongmin
Journal:   Marine Drugs
Volume:   11
edition:   6
Year:   2013
Pages:   1800
DOI:   10.3390/md11061800
Publication date:   24-May-2013
More about Molecular Diversity Preservation International
Your browser is not current. Microsoft Internet Explorer 6.0 does not support some functions on Chemie.DE